HPA011024

MRAP antibody from Sigma-Aldrich
B27, C21orf61, FALP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011024
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011024, RRID:AB_10599292
Product name
Anti-MRAP antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011024
Antibody type
Polyclonal
Antigen
melanocortin 2 receptor accessory protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MANGTNASAPYYSYEYYLDYLDLIPVDEKKLKAHK
HS
Storage
-20C
Provider Type Product Number
- No reagents -