HPA011093

MRAP antibody from MilliporeSigma / Merck KGaA
B27, C21orf61, FALP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011093
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA011093, RRID:AB_10600889
Product name
Anti-MRAP antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA011093
Antibody type
Polyclonal
Antigen
melanocortin 2 receptor accessory protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PKHHQTCPWSHGLNLHLCIQKCLPCHREPLATSQA
QASSVEPGSRTGPDQPLRQESSSTLPLGGFQTHPT
LLWELTLNGGPLVRSKPSEPPPGDRTSQLQS
Storage
-20C
Provider Type Product Number
- No reagents -