SAB1400334

MTMR6 antibody from Sigma-Aldrich
ELISA
Recommended by provider

Antibody data

Product number
SAB1400334
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB1400334, RRID:AB_1854189
Product name
Anti-MTMR6 antibody produced in mouse
Provider product page
Sigma-Aldrich - SAB1400334
Antibody type
Polyclonal
Antigen
MTMR6 (AAH40012.1, a.a. 1-621) full-length human protein.
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
MEHIRTTKVEQVKLLDRFSTSNKSLTGTLYLTATH
LLFIDSHQKETWILHHHIASVEKLALTTSGCPLVI
QCKNFRTVHFIVPRERDCHDIYNSLLQLSKQAKYE
DLYAFSYNPKQNDSERLQGWQLIDLAEEYKRMGVP
NSHWQLSDANRDYKICETYPRELYVPRIASKPIIV
GSSKFRSKGRFPVLSYYHQDKEAAICRCSQPLSGF
SARCLEDEHLLQAISKANPVNRYMYVMDTRPKLNA
MANRAAGKGYENEDNYSNIRFQFVGIENIHVMRSS
LQKLLEVNGTKGLSVNDFYSGLESSGWLRHIKAVM
DAAVFLAKAITVENASVLVHCSDGWDRTSQVCSLG
SLLLDSYYRTIKGFMVLIEKDWISFGHKFSERCGQ
LDGDPKEVSPVFTQFLECVWHLTEQFPQAFEFSEA
FLLQIHEHIHSCQFGNFLGNCQKEREELKLKEKTY
Storage
-20C
Provider Type Product Number
- No reagents -