Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA010851 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA010851, RRID:AB_1079533
- Product name
- Anti-OSTM1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
REAYKTLSSLYSEMQKMNELENKAEPGTHLCIDVE
DAMNITRKLWSRTFNCSVP- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Omi, a recessive mutation on chromosome 10, is a novel allele of Ostm1.
Degradation of Alzheimer's amyloid fibrils by microglia requires delivery of ClC-7 to lysosomes
Bosman EA, Estabel J, Ismail O, Podrini C, White JK, Steel KP
Mammalian genome : official journal of the International Mammalian Genome Society 2013 Feb;24(1-2):44-53
Mammalian genome : official journal of the International Mammalian Genome Society 2013 Feb;24(1-2):44-53
Degradation of Alzheimer's amyloid fibrils by microglia requires delivery of ClC-7 to lysosomes
Majumdar A, Capetillo-Zarate E, Cruz D, Gouras G, Maxfield F
Molecular Biology of the Cell 2011 May;22(10):1664-1676
Molecular Biology of the Cell 2011 May;22(10):1664-1676
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Recombinant expression validation
- Main image
- Experimental details
- Western blot analysis in control (vector only transfected HEK293T lysate) and OSTM1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY402271).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.
- Sample type
- HUMAN