HPA010851

OSTM1 antibody from Sigma-Aldrich
GL, HSPC019
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010851
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010851, RRID:AB_1079533
Product name
Anti-OSTM1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010851
Antibody type
Polyclonal
Antigen
Osteopetrosis-associated transmembrane protein 1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
REAYKTLSSLYSEMQKMNELENKAEPGTHLCIDVE
DAMNITRKLWSRTFNCSVP
Storage
-20C
Provider Type Product Number
- No reagents -