HPA010806

B4GALT1 antibody from Atlas Antibodies
beta4Gal-T1, GGTB2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA010806
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA010806, RRID:AB_1078255
Product name
Anti-B4GALT1
Provider product page
Atlas Antibodies - HPA010806
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
FRGMSISRPNAVVGRCRMIRHSRDKKNEPNPQRFD
RIAHTKETMLSDGLNSLTYQVLDVQRYPLYTQITV
DIGTPS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -