HPA010806

antibody from Atlas Antibodies

Targeting: B4GALT1 beta4Gal-T1, GGTB2

Antibody data

Submit

Validation data

Product number: HPA010806 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA010806, RRID:AB_1078255
Product name: Anti-B4GALT1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: FRGMSISRPNAVVGRCRMIRHSRDKKNEPNPQRFD RIAHTKETMLSDGLNSLTYQVLDVQRYPLYTQITV DIGTPS
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

B4GALT1 protein structure - HPA010806 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, liver, prostate and testis using Anti-B4GALT1 antibody HPA010806 (A) shows similar protein distribution across tissues to independent antibody HPA010807 (B).
Antibody #2 product nr: HPA010807
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lateral ventricle shows strong granular cytoplasmic positivity in neuronal cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human prostate using Anti-B4GALT1 antibody HPA010806.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-B4GALT1 antibody HPA010806.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-B4GALT1 antibody HPA010806.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-B4GALT1 antibody HPA010806.
Sample type: HUMAN