HPA010806

B4GALT1 antibody from Sigma-Aldrich
beta4Gal-T1, GGTB2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010806
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010806, RRID:AB_1078255
Product name
Anti-B4GALT1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010806
Antibody type
Polyclonal
Antigen
beta-1,4-Galactosyltransferase 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FRGMSISRPNAVVGRCRMIRHSRDKKNEPNPQRFD
RIAHTKETMLSDGLNSLTYQVLDVQRYPLYTQITV
DIGTPS
Storage
-20C
Provider Type Product Number
- No reagents -