WH0090441M2

ZNF622 antibody from Sigma-Aldrich
MGC17552, MGC2485, ZPR9
ELISA
Recommended by provider
Immunocytochemistry
Recommended by provider

Antibody data

Product number
WH0090441M2
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#WH0090441M2, RRID:AB_1844312
Product name
Monoclonal Anti-ZNF622 antibody produced in mouse
Provider product page
Sigma-Aldrich - WH0090441M2
Antibody type
Monoclonal
Antigen
ZNF622 (NP_219482, a.a. 1-101) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human, Mouse
Antigen sequence
MATYTCITCRVAFRDADMQRAHYKTDWHRYNLRRK
VASMAPVTAEGFQERVRAQRAVAEEESKGSATYCT
VCSKKFASFNAYENHLKSRRHVELEKKAVQ* (wi
thout GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -