HPA036514

ZNF622 antibody from Atlas Antibodies
MGC17552, MGC2485, ZPR9
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA036514
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA036514, RRID:AB_2675167
Product name
Anti-ZNF622
Provider product page
Atlas Antibodies - HPA036514
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VAHMTKDHSFFIPDIEYLSDIKGLIKYLGEKVGVG
KICLWCNEKGKSFYSTEAVQAHMNDKSHCKLFTDG
DAALEFADFYDFRSSYPDHKEGE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -