Antibody data

Product number
H00090441-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00090441-M02, RRID:AB_535102
Product name
ZNF622 monoclonal antibody (M02), clone 3C5
Provider product page
Abnova Corporation - H00090441-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant ZNF622.
Antigen sequence
MATYTCITCRVAFRDADMQRAHYKTDWHRYNLRRK
VASMAPVTAEGFQERVRAQRAVAEEESKGSATYCT
VCSKKFASFNAYENHLKSRRHVELEKKAVQ
Isotype
IgG
Antibody clone number
3C5
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -