H00090441-B01

ZNF622 antibody from Abnova Corporation
MGC17552, MGC2485, ZPR9

Antibody data

Product number
H00090441-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00090441-B01, RRID:AB_1116332
Product name
ZNF622 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00090441-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human ZNF622 protein.
Antigen sequence
MATYTCITCRVAFRDADMQRAHYKTDWHRYNLRRK
VASMAPVTAEGFQERVRAQRAVAEEESKGSATYCT
VCSKKFASFNAYENHLKSRRHVELEKKAVQAVNRK
VEMMNEKNLEKGLGVDSVDKDAMNAAIQQAIKAQP
SMSPKKAPPAPAKEARNVVAVGTGGRGTHDRDPSE
KPPRLQWFEQQAKKLAKQQEEDSEEEEEDLDGDDW
EDIDSDEELECEDTEAMDDVVEQDAEEEEAEEGPP
LGAIPITDCLFCSHHSSSLMKNVAHMTKDHSFFIP
DIEYLSDIKGLIKYLGEKVGVGKICLWCNEKGKSF
YSTEAVQAHMNDKSHCKLFTDGDAALEFADFYDFR
SSYPDHKEGEDPNKAEELPSEKNLEYDDETMELIL
PSGARVGHRSLMRYYKQRFGLSRAVAVAKNRKAVG
RVLQQYRALGWTGSTGAALMRERDMQYVQRMKSKW
MLKTGMKNNATKQMHFRVQVRF
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -