SAB1401933

ZNF622 antibody from Sigma-Aldrich
MGC17552, MGC2485, ZPR9
ELISA
Recommended by provider

Antibody data

Product number
SAB1401933
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB1401933, RRID:AB_10608043
Product name
Monoclonal Anti-ZNF622 antibody produced in mouse
Provider product page
Sigma-Aldrich - SAB1401933
Antibody type
Monoclonal
Antigen
ZNF622 (NP_219482, 1 a.a. ~ 101 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Description
purified immunoglobulin
Reactivity
Human, Mouse, Rat
Antigen sequence
MATYTCITCRVAFRDADMQRAHYKTDWHRYNLRRK
VASMAPVTAEGFQERVRAQRAVAEEESKGSATYCT
VCSKKFASFNAYENHLKSRRHVELEKKAVQ*
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -