Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [3]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00027065-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00027065-M01, RRID:AB_425941
- Product name
- D4S234E monoclonal antibody (M01), clone 1C3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant D4S234E.
- Antigen sequence
MVKLGNNFAEKGTKQPLLEDGFDTIPLMTPLDVNQ
LQFPPPDKVVVKTKTEYEPDRKKGKARPPQIAEFT
VSITEGVTERFKVSVLVLFALAFLTCVVFLVVYKV
YKYDRACPDGFVLKNTQCIPEGLESYYAEQDSSAR
EKFYTVINHYNLAKQSITRSVSPWMSVLSEEKLSE
QETEAAEKSA- Isotype
- IgG
- Antibody clone number
- 1C3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references D4S234E, a novel p53-responsive gene, induces apoptosis in response to DNA damage.
Kudoh T, Kimura J, Lu ZG, Miki Y, Yoshida K
Experimental cell research 2010 Oct 15;316(17):2849-58
Experimental cell research 2010 Oct 15;316(17):2849-58
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- D4S234E monoclonal antibody (M01), clone 1C3 Western Blot analysis of D4S234E expression in IMR-32 ( Cat # L008V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- D4S234E monoclonal antibody (M01), clone 1C3. Western Blot analysis of D4S234E expression in PC-12.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- D4S234E monoclonal antibody (M01), clone 1C3. Western Blot analysis of D4S234E expression in rat brain.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged D4S234E is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol