HPA030596

CARMIL3 antibody from MilliporeSigma / Merck KGaA
BC008134, C14orf121, crml-1, LRRC16B
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA030596
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA030596, RRID:AB_10603012
Product name
Anti-LRRC16B antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA030596
Antibody type
Polyclonal
Antigen
leucine rich repeat containing 16B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CDYNGLHCREEVQWDVDTIYHAEDNREFNLLDFSH
LESRDLALMVAALAYNQWFTKLYCKDLRLGSEVLE
QVLHTLSKSGSLEELVLDNAGLKTDFVQKLAGVFG
ENGSCVLHALTL
Storage
-20C
Provider Type Product Number
- No reagents -