HPA017235

UBA5 antibody from Atlas Antibodies
FLJ23251, UBE1DC1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA017235
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA017235, RRID:AB_1236046
Product name
Anti-UBA5
Provider product page
Atlas Antibodies - HPA017235
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GIGKLLLFDYDKVELANMNRLFFQPHQAGLSKVQA
AEHTLRNINPDVLFEVHNYNITTVENFQHFMDRIS
NGGLEEGKPVDLVLSCVDNFEARMTINTACNELGQ
TWMESGVSENAVSGHIQLIIPGESACFACAPPLVV
AANIDEKTL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -