HPA014466

PCDHB4 antibody from Sigma-Aldrich
PCDH-BETA4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014466
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014466, RRID:AB_1855058
Product name
Anti-PCDHB4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014466
Antibody type
Polyclonal
Antigen
Protocadherin beta-4 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LCGPIEPCVLHFQVFLEMPVQFFQGELLIQDINDH
SPIFPEREVLLKILENSQPGTLFPLLIAEDLDVGS
NGLQKYTISPNSHFHILTRNHSEGKKYPDLV
Storage
-20C
Provider Type Product Number
- No reagents -