H00054360-A02

CYTL1 antibody from Abnova Corporation
C17, C4orf4
No application information provided.

Antibody data

Product number
H00054360-A02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00054360-A02, RRID:AB_1139193
Product name
CYTL1 polyclonal antibody (A02)
Provider product page
Abnova Corporation - H00054360-A02
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length recombinant CYTL1.
Antigen sequence
MRTPGPLPVLLLLLAGAPAARPTPPTCYSRMRALS
QEITRDFNLLQVSEPSEPCVRYLPRLYLDIHNYCV
LDKLRDFVASPPCWKVAQVDSLKDKARKLYTIMNS
FCRRDLVFLLDDCNALEYPIPVTTALPDRQR
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -