Antibody data

Product number
H00008786-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00008786-B01, RRID:AB_1579729
Product name
RGS11 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00008786-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human RGS11 protein.
Antigen sequence
MAAGPAPPPGRPRAQMPHLRKMERVVVSMQDPDQG
VKMRSQRLLVTVIPHAVTGSDVVQWLAQKFCVSEE
EALHLGAVLVQHGYIYPLRDPRSLMLRPDETPYRF
QTPYFWTSTLRPAAELDYAIYLAKKNIRKRGTLVD
YEKDCYDRLHKKINHAWDLVLMQAREQLRAAKQRS
KGDRLVIACQEQTYWLVNRPPPGAPDVLEQGPGRG
SCAASRVLMTKSADFHKREIEYFRKALGRTRVKSS
VCLEAYLSFCGQRGPHDPLVSGCLPSNPWISDNDA
YWVMNAPTVAAPTKLRVERWGFSFRELLEDPVGRA
HFMDFLGKEFSGENLSFWEACEELRYGAQAQVPTL
VDAVYEQFLAPGAAHWVNIDSRTMEQTLEGLRQPH
RYVLDDAQLHIYMLMKKDSYPRFLKSDMYKALLAE
AGIPLEMKRRVFPFTWRPRHSSPSPALLPTPVEPT
AACGPGGGDGVA
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -