H00023784-B01

POTEH antibody from Abnova Corporation
A26C3, ACTBL1, CT104.7, POTE22

Antibody data

Product number
H00023784-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00023784-B01, RRID:AB_1203934
Product name
ACTBL1 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00023784-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human ACTBL1 protein.
Antigen sequence
MVAEAGSMPAASSVKKPFGLRSKMGKWCRHCFAWC
RGSGKSNVGTSGDHDDSAMKTLRSKMGKWCCHCFP
WCRGSGKSNVGTSGDHDDSAMKTLRSKMGKWCCHC
FPCCRGSGKSNVGTSGDHDDSAMKTLRSKMGKWCC
HCFPCCRGSGKNKVGPWGDYDDSAFMEPRYHVRRE
DLDKLHRAAWWGKVPRKDLIVMLKDTDMNKKDKQK
RTALHLASANGNSEVVKLLLDRRCQLNILDNKKRT
ALTKAVQCQEDECALMLLEHGTDPNIPDEYGNTAL
HYAIYNED
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -