HPA008755

PCDHGA2 antibody from Atlas Antibodies
PCDH-GAMMA-A2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA008755
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA008755, RRID:AB_888805
Product name
Anti-PCDHGA2
Provider product page
Atlas Antibodies - HPA008755
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PNTDWRFSQAQRPGTSGSQNGDDTGTWPNNQFDTE
MLQAMILASASEAADGSSTLGGGAGTMGLSARYGP
QFTLQHVPDYRQNVYIPGSNATLTNAAGKRDGKAP
AGGNGNKKKSGKKEK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -