HPA008755

PCDHGA2 antibody from Sigma-Aldrich
PCDH-GAMMA-A2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008755
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008755, RRID:AB_1079577
Product name
Anti-PCDHGA12 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008755
Antibody type
Polyclonal
Antigen
Protocadherin gamma A12 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PNTDWRFSQAQRPGTSGSQNGDDTGTWPNNQFDTE
MLQAMILASASEAADGSSTLGGGAGTMGLSARYGP
QFTLQHVPDYRQNVYIPGSNATLTNAAGKRDGKAP
AGGNGNKKKSGKKEK
Storage
-20C
Provider Type Product Number
- No reagents -