HPA042303

ACAA2 antibody from Atlas Antibodies
DSAEC
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA042303
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA042303, RRID:AB_10794046
Product name
Anti-ACAA2
Provider product page
Atlas Antibodies - HPA042303
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LLRGVFVVAAKRTPFGAYGGLLKDFTATDLSEFAA
KAALSAGKVSPETVDSVIMGNVLQSSSDAIYLARH
VGLRVGIPKETPALTINRLCGSGFQSIVNGCQEIC
VKEAEVVLCGGTESMSQAPYCVRNVRFGTKLGSDI
KLEDSLW
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -