Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010449-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010449-M01, RRID:AB_565441
- Product name
- ACAA2 monoclonal antibody (M01), clone 5C4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ACAA2.
- Antigen sequence
SLTDQHVQLPMAMTAENLTVKHKISREECDKYALQ
SQQRWKAANDAGYFNDEMAPIEVKTKKGKQTMQVD
EHARPQTTLEQLQKLPPVFKKDGTVTAGNASGVAD
GAGAV- Isotype
- IgG
- Antibody clone number
- 5C4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Opposing effects of dietary sugar and saturated fat on cardiovascular risk factors and glucose metabolism in mitochondrially impaired mice.
Kuhlow D, Zarse K, Voigt A, Schulz TJ, Petzke KJ, Schomburg L, Pfeiffer AF, Ristow M
European journal of nutrition 2010 Oct;49(7):417-27
European journal of nutrition 2010 Oct;49(7):417-27
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- ACAA2 monoclonal antibody (M01), clone 5C4 Western Blot analysis of ACAA2 expression in HeLa ( Cat # L013V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged ACAA2 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to ACAA2 on HeLa cell. [antibody concentration 40 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to ACAA2 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol