Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010449-M05 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010449-M05, RRID:AB_1112378
- Product name
- ACAA2 monoclonal antibody (M05), clone 2F7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ACAA2.
- Antigen sequence
SLTDQHVQLPMAMTAENLTVKHKISREECDKYALQ
SQQRWKAANDAGYFNDEMAPIEVKTKKGKQTMQVD
EHARPQTTLEQLQKLPPVFKKDGTVTAGNASGVAD
GAGAV- Isotype
- IgG
- Antibody clone number
- 2F7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- ACAA2 monoclonal antibody (M05), clone 2F7. Western Blot analysis of ACAA2 expression in Raw 264.7 ( Cat # L024V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged ACAA2 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol