HPA010593

FOLH1 antibody from Atlas Antibodies
FOLH, GCP2, GCPII, NAALAD1, NAALAdase, PSM, PSMA
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA010593
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA010593, RRID:AB_888436
Product name
Anti-FOLH1
Provider product page
Atlas Antibodies - HPA010593
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGD
PLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYD
AQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGN
F
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -