HPA010593

FOLH1 antibody from Sigma-Aldrich
FOLH, GCP2, GCPII, NAALAD1, NAALAdase, PSM, PSMA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010593
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010593, RRID:AB_1079685
Product name
Anti-FOLH1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010593
Antibody type
Polyclonal
Antigen
Glutamate carboxypeptidase 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGD
PLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYD
AQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGN
F
Storage
-20C
Provider Type Product Number
- No reagents -