HPA031157

DCAF11 antibody from MilliporeSigma / Merck KGaA
GL014, PRO2389, WDR23
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA031157
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA031157, RRID:AB_10603002
Product name
Anti-WDR23 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA031157
Antibody type
Polyclonal
Antigen
DDB1 and CUL4 associated factor 11 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NSKDQTIKLWDIRRFSSREGMEASRQAATQQNWDY
RWQQVPKKAWRKLKLPGDSSLMTYRGHGVLHTLIR
CRFSPIHSTGQQFIYSGCSTGKVVVYDLLSGHIVK
KLTNHKACVRDVSWHPFEEKIVSSSWDG
Storage
-20C
Provider Type Product Number
- No reagents -