HPA003379

XKR3 antibody from Sigma-Aldrich
MGC57211, XTES
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003379
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003379, RRID:AB_10602682
Product name
Anti-XKR3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003379
Antibody type
Polyclonal
Antigen
XK, Kell blood group complex subunit-related family, member 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TIRNYHKWLKNLKQEKEETQVSITKRNTMLEREIA
FSIRDNFMQQKAFK
Storage
-20C
Provider Type Product Number
- No reagents -