HPA010631

PIANP antibody from Sigma-Aldrich
C12orf53, DKFZp547D2210, PANP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010631
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010631, RRID:AB_10603680
Product name
Anti-C12orf53 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010631
Antibody type
Polyclonal
Antigen
Uncharacterized protein C12orf53 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DRSQKRRRPSGQQGALRQEESQQPLTDLSPAGVTV
LGAFGDSPTPTPDHEEPRGGPRPGMPHPKGAPAFQ
LNR
Storage
-20C
Provider Type Product Number
- No reagents -