PAB20603

GRAMD1A antibody from Abnova Corporation
FLJ90346, KIAA1533

Antibody data

Product number
PAB20603
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20603, RRID:AB_10963684
Product name
GRAMD1A polyclonal antibody
Provider product page
Abnova Corporation - PAB20603
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant GRAMD1A.
Antigen sequence
SSTGEEADLAALLPDLSGRLLINSVFHVGAERLQQ
MLFSDSPFLQGFLQQCKFTDVTLSPWSGDSKCHQR
RVLTYTIPISNPLGPKSASVVETQTLFRRGPQAGG
CVVDSEVLTQGIPYQDYFYTAHRY
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -