HPA008852

GRAMD1A antibody from Atlas Antibodies
FLJ90346, KIAA1533
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA008852
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA008852, RRID:AB_1079203
Product name
Anti-GRAMD1A
Provider product page
Atlas Antibodies - HPA008852
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SEDEDYVSPLQLNGLGTPKEVGDVIALSDITSSGA
ADRSQEPSPVGSRRGHVTPNLSRASSDADHGAEED
KEEQVDSQPDASSSQTVTPVAEPPSTEPTQPDGPT
TLGPLDLLPS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -