HPA008852

GRAMD1A antibody from Sigma-Aldrich
FLJ90346, KIAA1533
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008852
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008852, RRID:AB_1079203
Product name
Anti-GRAMD1A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008852
Antibody type
Polyclonal
Antigen
GRAM domain containing 1A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SEDEDYVSPLQLNGLGTPKEVGDVIALSDITSSGA
ADRSQEPSPVGSRRGHVTPNLSRASSDADHGAEED
KEEQVDSQPDASSSQTVTPVAEPPSTEPTQPDGPT
TLGPLDLLPS
Storage
-20C
Provider Type Product Number
- No reagents -