HPA047252

RPL21 antibody from Atlas Antibodies
DKFZp686C06101, FLJ27458, L21, MGC104274, MGC104275, MGC71252
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA047252
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA047252, RRID:AB_2680000
Product name
Anti-RPL21
Provider product page
Atlas Antibodies - HPA047252
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RGTRYMFSRPFRKHGVVPLATYMRIYKKGD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -