HPA003757

PAXBP1 antibody from Atlas Antibodies
C21orf66, fSAP105, GCFC, GCFC1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003757
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003757, RRID:AB_10600796
Product name
Anti-PAXBP1
Provider product page
Atlas Antibodies - HPA003757
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ALSSLNVLRPGEIPDAAFIHAARKKRQMARELGDF
TPHDNEPGKGRLVREDENDASDDEDDDEKRRIVFS
VKEKSQRQKIAEEIGIEGSDDDALVTGEQDEELSR
WEQEQIRKGINIPQVQASQPAEVNMYYQNT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -