H00094104-B01P

PAXBP1 antibody from Abnova Corporation
C21orf66, fSAP105, GCFC, GCFC1

Antibody data

Product number
H00094104-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00094104-B01P, RRID:AB_1571849
Product name
C21orf66 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00094104-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human C21orf66 protein.
Antigen sequence
MFRKARRVNVRKRNDSEEEERERDEEQEPPPLLPP
PGTGEEAGPGGGDRAPGGESLLGPGPSPPSALTPG
LGAEAGGGFPGGAEPGNGLKPRKRPRENKEVPRAS
LLSFQDEEEENEEVFKVKKSSYSKKIVKLLKKEYK
EDLEKSKIKTELNSSAESEQPLDKTGHVKDTNQED
GVIISEHGEDEMDMESEKEEEKPKTGGAFSNALSS
LNVLRPGEIPDAAFIHAARKKRQMARELGDFTPHD
NEPGKGRLVREDENDASDDEDDDEKRRIVFSVKEK
SQRQKIAEEIGIEGSDDDALVTGEQDEELSRWEQE
QIRKGINIPQVQASQPAEVNMYYQNTYQTMPYGSS
YGIPYSYTAYGSSDAKSQKTDNTVPFKTPSNEMTP
VTIDLVKKQLKDR
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -