ABIN405932

PAXBP1 antibody from antibodies-online
C21orf66, fSAP105, GCFC, GCFC1

Antibody data

Product number
ABIN405932
Provider
antibodies-online
Product name
anti-GC-Rich Sequence DNA-Binding Factor 1 (GCFC1) (N-Term) antibody
Provider product page
antibodies-online - ABIN405932
Antibody type
Polyclonal
Antigen
The immunogen for anti-C21orf66 antibody: synthetic peptide directed towards the N terminal of human C21orf66
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Canine, Chicken/Avian, Rabbit, Xenopus, Zebrafish
Host
Rabbit
Antigen sequence
PGEIPDAAFIHAARKKRQMARELGDFTPHDNEPGK
GRLVR EDENDASDDE
Epitope
N-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -