SAB1400772

PAXBP1 antibody from MilliporeSigma / Merck KGaA
C21orf66, fSAP105, GCFC, GCFC1
ELISA
Recommended by provider
Immunocytochemistry
Recommended by provider

Antibody data

Product number
SAB1400772
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#SAB1400772, RRID:AB_1845706
Product name
Anti-C21orf66 antibody produced in mouse
Provider product page
MilliporeSigma / Merck KGaA - SAB1400772
Antibody type
Polyclonal
Antigen
C21orf66 (AAH30539.1, a.a. 1-398) full-length human protein.
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
MFRKARRVNVRKRNDSEEEERERDEEQEPPPLLPP
PGTGEEAGPGGGDRAPGGESLLGPGPSPPSALTPG
LGAEAGGGFPGGAEPGNGLKPRKRPRENKEVPRAS
LLSFQDEEEENEEVFKVKKSSYSKKIVKLLKKEYK
EDLEKSKIKTELNSSAESEQPLDKTGHVKDTNQED
GVIISEHGEDEMDMESEKEEEKPKTGGAFSNALSS
LNVLRPGEIPDAAFIHAARKKRQMARELGDFTPHD
NEPGKGRLVREDENDASDDEDDDEKRRIVFSVKEK
SQRQKIAEEIGIEGSDDDALVTGEQDEELSRWEQE
QIRKGINIPQVQASQPAEVNMYYQNTYQTMPYGSS
YGIPYSYTAYGSSDAKSQKTDNTVPFKTPSNEMTP
VTIDLVKKQLKDR (without GST)
Storage
-20C
Provider Type Product Number
- No reagents -