HPA008853

ATRN antibody from Sigma-Aldrich
DPPT-L, MGCA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008853
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008853, RRID:AB_1078248
Product name
Anti-ATRN antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008853
Antibody type
Polyclonal
Antigen
Attractin precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LLLSDILVFTSEQCDAHRSEAACLAAGPGIRCVWN
TGSSQCISWALATDEQEEKLKSECFSKRTLDHDRC
DQHTDCYSCTANTNDCHWCNDHCVPRNHSCSEGQI
SIFRYENCPKDNPMYYCNKKTSCRSCALDQNCQWE
Storage
-20C
Provider Type Product Number
- No reagents -