H00005522-M01
antibody from Abnova Corporation
Targeting: PPP2R2C
B55gamma, IMYPNO, MGC33570, PR52, PR55G
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005522-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005522-M01, RRID:AB_606826
- Product name
- PPP2R2C monoclonal antibody (M01), clone 6D1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PPP2R2C.
- Antigen sequence
MGEDTDTRKINHSFLRDHSYVTEADIISTVEFNHT
GELLATGDKGGRVVIFQREPESKNAPHSQGEYDVY
STFQSHEPEFDYLKSLEIEEKINKIKWLPQQNAAH
SLLST- Isotype
- IgG
- Antibody clone number
- 6D1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references PPP2R2C loss promotes castration-resistance and is associated with increased prostate cancer-specific mortality.
Bluemn EG, Spencer ES, Mecham B, Gordon RR, Coleman I, Lewinshtein D, Mostaghel E, Zhang X, Annis J, Grandori C, Porter C, Nelson PS
Molecular cancer research : MCR 2013 Jun;11(6):568-78
Molecular cancer research : MCR 2013 Jun;11(6):568-78
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- PPP2R2C monoclonal antibody (M01), clone 6D1 Western Blot analysis of PPP2R2C expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of PPP2R2C expression in transfected 293T cell line by PPP2R2C monoclonal antibody (M01), clone 6D1.Lane 1: PPP2R2C transfected lysate(49.5 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged PPP2R2C is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol