HPA010856

FXYD3 antibody from Sigma-Aldrich
MAT-8, PLML
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010856
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010856, RRID:AB_1078915
Product name
Anti-FXYD3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010856
Antibody type
Polyclonal
Antigen
FXYD domain-containing ion transport regulator 3 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MSEWRSSGEQAGRGWGSPPLTTQLSPTGAKCKCKF
GQKSGHHPGETPPLITPGSAQS
Storage
-20C
Provider Type Product Number
- No reagents -