Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunoprecipitation [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005721-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005721-M02, RRID:AB_464006
- Product name
- PSME2 monoclonal antibody (M02), clone 1G4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PSME2.
- Antigen sequence
MAKPCGVRLSGEARKQVEVFRQNLFQEAEEFLYRF
LPQKIIYLNQLLQEDSLNVADLTSLRAPLDIPIPD
PPPKDDEMETDKQEKKEVHK- Isotype
- IgG
- Antibody clone number
- 1G4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- PSME2 monoclonal antibody (M02), clone 1G4 Western Blot analysis of PSME2 expression in MCF-7 ( Cat # L046V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of PSME2 expression in transfected 293T cell line by PSME2 monoclonal antibody (M02), clone 1G4.Lane 1: PSME2 transfected lysate(27.4 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged PSME2 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of PSME2 transfected lysate using anti-PSME2 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with PSME2 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to PSME2 on formalin-fixed paraffin-embedded human stomach carcinoma. [antibody concentration 6 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol