H00374291-M01

NDUFS7 antibody from Abnova Corporation
CI-20, FLJ45860, FLJ46880, PSST
No application information provided.

Antibody data

Product number
H00374291-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00374291-M01, RRID:AB_1137327
Product name
NDUFS7 monoclonal antibody (M01), clone 3A3
Provider product page
Abnova Corporation - H00374291-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant NDUFS7.
Antigen sequence
PRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVV
SMGSCANGGGYYHYSYSVVRGCDRIVPVDIYIPGC
PPTAEALLYGILQLQRKIKRERRLQIWYRR
Isotype
IgG
Antibody clone number
3A3
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -