Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00374291-M01 - Provider product page 
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00374291-M01, RRID:AB_1137327
- Product name
- NDUFS7 monoclonal antibody (M01), clone 3A3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant NDUFS7.
- Antigen sequence
- PRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVV
 SMGSCANGGGYYHYSYSVVRGCDRIVPVDIYIPGC
 PPTAEALLYGILQLQRKIKRERRLQIWYRR
- Isotype
- IgG
- Antibody clone number
- 3A3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references		Mitochondrial complex I activity and oxidative damage to mitochondrial proteins in the prefrontal cortex of patients with bipolar disorder.
				
		
	
			Andreazza AC, Shao L, Wang JF, Young LT
Archives of general psychiatry 2010 Apr;67(4):360-8
		Archives of general psychiatry 2010 Apr;67(4):360-8
				No comments: Submit comment	
	
			
			No validations: Submit validation data