HPA013967

LAG3 antibody from Sigma-Aldrich
CD223
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013967
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013967, RRID:AB_1846277
Product name
Anti-LAG3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013967
Antibody type
Polyclonal
Antigen
Lymphocyte activation gene 3 protein precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQL
NATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQ
ERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQC
QLYQGERLLGAAVYFTELSSPGAQ
Storage
-20C
Provider Type Product Number
- No reagents -