Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN630904 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Guanidinoacetate N-Methyltransferase (GAMT) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- GAMT antibody was raised using the middle region of GAMT corresponding to a region with amino acids PGEGPFLTPWVGWTVLVHLEIKVLCLAQWLPGAVAQVYNPSTVEGRGGQI
- Description
- Affinity purified
- Reactivity
- Human
- Host
- Rabbit
- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1 mg/mL
- Storage
- Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
- Handling
- Avoid repeated freeze/thaw cycles. Dilute only prior to immediate use.
No comments: Submit comment
No validations: Submit validation data