Antibody data

Product number
H00002593-M04
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00002593-M04, RRID:AB_1575082
Product name
GAMT monoclonal antibody (M04), clone 3H4
Provider product page
Abnova Corporation - H00002593-M04
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant GAMT.
Antigen sequence
PLSEETWHTHQFNFIKNHAFRLLKPGGVLTYCNLT
SWGELMKSKYSDITIMFEETQVPALLEAGFRRENI
RTEVMALVPPADCRYYAFPQMITPLVTK
Isotype
IgG
Antibody clone number
3H4
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -