ABIN630612

antibody from antibodies-online

Targeting: POLR1D AC19, MGC9850, RPA16, RPA9, RPAC2, RPO1-3

Western blot

Antibody data

Submit

Validation data

Product number: ABIN630612 - Provider product page
Provider: antibodies-online
Product name: anti-Polymerase (RNA) I Polypeptide D, 16kDa (POLR1D) antibody
Antibody type: Polyclonal
Antigen: POLR1 D antibody was raised using a synthetic peptide corresponding to a region with amino acids TRGTLPAVEPFQRGLNELMNVCQHVLDKFEASIKDYKDQKASRNESTF
Description: Affinity purified
Reactivity: Human
Host: Rabbit
Vial size: 50 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles.

POLR1D protein structure - ABIN630612 shown in red.