H00051082-B01

POLR1D antibody from Abnova Corporation
MGC9850, RPA16, RPA9, RPAC2, RPO1-3

Antibody data

Product number
H00051082-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00051082-B01, RRID:AB_1114920
Product name
POLR1D MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00051082-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human POLR1D protein.
Antigen sequence
MEEDQELERKISGLKTSMAEGERKTALEMVQAAGT
DRHCVTFVLHEEDHTLGNSLRYMIMKNPEVEFCGY
TTTHPSESKINLRIQTRGTLPAVEPFQRGLNELMN
VCQHVLDKFEASIKDYKDQKASRNESTF
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -