HPA010859

MLF2 antibody from Sigma-Aldrich
NTN4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010859
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010859, RRID:AB_1079388
Product name
Anti-MLF2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010859
Antibody type
Polyclonal
Antigen
Myeloid leukemia factor 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MIGNMEHMTAGGNCQTFSSSTVISYSNTGDGAPKV
YQETSEMRSAPGGIRETRRTVRDSDSGLEQMSIGH
HIRDRAHILQRSRNHRTGDQEERQDYINLDESEAA
AFDDEWRRETSRFRQQRPLEFRRLESSGA
Storage
-20C
Provider Type Product Number
- No reagents -