Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN501620 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Pancreatic and Duodenal Homeobox 1 (PDX1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-PDX1 antibody: synthetic peptide directed towards the N terminal of human PDX1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine
- Host
- Rabbit
- Antigen sequence
MNGEEQYYAATQLYKDPCAFQRGPAPEFSASPPAC
LYMGR QPPPPPPHPF- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Association of genetic variants with atherothrombotic cerebral infarction in Japanese individuals with metabolic syndrome.
Yamada Y, Kato K, Oguri M, Yoshida T, Yokoi K, Watanabe S, Metoki N, Yoshida H, Satoh K, Ichihara S, Aoyagi Y, Yasunaga A, Park H, Tanaka M, Nozawa Y
International journal of molecular medicine 2008 Jun;21(6):801-8
International journal of molecular medicine 2008 Jun;21(6):801-8
No comments: Submit comment
No validations: Submit validation data