Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Immunocytochemistry [3]
Submit
Validation data
Reference
Comment
Report error
- Product number
- 29470002-0.1mg - Provider product page
- Provider
- Novus Biologicals
- Product name
- Rabbit Polyclonal REC8 Antibody
- Antibody type
- Polyclonal
- Description
- Immunogen affinity purified. This product is specific for C
- Host
- Rabbit
- Antigen sequence
MRTEEELENVRRRQKSSLGVQFMRTDDLEEDTRRN
RLFEDEERTRDAREDELFFYSSGSLLPNNRLNIHK
ELLNEAEARYPEWVNFNEFTADHDRKKAAT- Isotype
- IgG
- Vial size
- 0.1 mg
- Storage
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
No comments: Submit comment
Supportive validation
- Submitted by
- Novus Biologicals (provider)
- Main image
- Experimental details
- Immunocytochemistry/Immunofluorescence: REC8 Antibody [29470002] - This image is specific to animal number SDQ0798 1:10000 Affinity Purified, 1:500 Serum
- Submitted by
- Novus Biologicals (provider)
- Main image
- Experimental details
- Immunocytochemistry/Immunofluorescence: REC8 Antibody [29470002] - This image is specific to animal number SDQ0798 1:10,000 Affinity Purified
- Submitted by
- Novus Biologicals (provider)
- Main image
- Experimental details
- Immunocytochemistry/Immunofluorescence: REC8 Antibody [29470002] - This image is specific to animal number SDQ0802 1:50000 Affinity Purified